Structure of PDB 6upl Chain K Binding Site BS01

Receptor Information
>6upl Chain K (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE
LAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAV
LLPK
Ligand information
>6upl Chain I (length=79) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcgtagacagctctagcaccgcttaaacgcacgtacgcgctgtcccccgc
gttttaaccgccaaggggattactcccta
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6upl FACT caught in the act of manipulating the nucleosome.
Resolution7.4 Å
Binding residue
(original residue number in PDB)		R42 V43 G44
Binding residue
(residue number reindexed from 1)		R28 V29 G30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008285 negative regulation of cell population proliferation
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6upl, PDBe:6upl, PDBj:6upl
PDBsum6upl
PubMed31775157
UniProtQ93077|H2A1C_HUMAN Histone H2A type 1-C (Gene Name=H2AC6)

[Back to BioLiP]