Structure of PDB 6tm5 Chain K Binding Site BS01

Receptor Information
>6tm5 Chain K (length=493) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTA
QYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLSIKSSICL
LRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKEL
LESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVV
VSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANEL
FYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYG
PAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNS
KLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKA
IGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSA
IGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYI
Ligand information
>6tm5 Chain W (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MLRRKPTRLELKLDDIEEFENIRKDL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tm5 A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.
Resolution3.9 Å
Binding residue
(original residue number in PDB)
Y242 Y243 F247 V276 E277 H342 L369 Y373 F403 H406 V410 F413 K443 W444 E445 P446 N449 N450 H453 K457 N478 Y487 S490 L491 F514 T517 M518 M525
Binding residue
(residue number reindexed from 1)
Y208 Y209 F213 V242 E243 H308 L335 Y339 F369 H372 V376 F379 K409 W410 E411 P412 N415 N416 H419 K423 N444 Y453 S456 L457 F480 T483 M484 M491
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0007346 regulation of mitotic cell cycle
GO:0016567 protein ubiquitination
GO:0031145 anaphase-promoting complex-dependent catabolic process
GO:0045842 positive regulation of mitotic metaphase/anaphase transition
GO:0051301 cell division
GO:0051445 regulation of meiotic cell cycle
GO:0070936 protein K48-linked ubiquitination
GO:0070979 protein K11-linked ubiquitination
GO:0141198 protein branched polyubiquitination
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005680 anaphase-promoting complex
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005819 spindle
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0072686 mitotic spindle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6tm5, PDBe:6tm5, PDBj:6tm5
PDBsum6tm5
PubMed32307883
UniProtQ13042|CDC16_HUMAN Cell division cycle protein 16 homolog (Gene Name=CDC16)

[Back to BioLiP]