Structure of PDB 6s01 Chain K Binding Site BS01

Receptor Information
>6s01 Chain K (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTRDFKPGDLIFAKMKGYPHWPARVDEVPPPTNKLPIFFFGTHETAFLGP
KDIFPYSENKEKYGKPNKRKGFNEGLWEIDNNPKVK
Ligand information
>6s01 Chain J (length=150) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atgcacaggatgtatatatctgacacgtgcctggagactagggagtaatc
cccttggcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggt
gctagagctgtctacgaccaattgagcggcctcggcaccgggattctgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6s01 Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		K14 K16 G17 K73
Binding residue
(residue number reindexed from 1)		K14 K16 G17 K68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0097100 supercoiled DNA binding
Biological Process
GO:0000395 mRNA 5'-splice site recognition
GO:0006338 chromatin remodeling
GO:0006979 response to oxidative stress
GO:0009408 response to heat
Cellular Component
GO:0000791 euchromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6s01, PDBe:6s01, PDBj:6s01
PDBsum6s01
PubMed31819277
UniProtO75475|PSIP1_HUMAN PC4 and SFRS1-interacting protein (Gene Name=PSIP1)

[Back to BioLiP]