Structure of PDB 6qx9 Chain K Binding Site BS01

Receptor Information
>6qx9 Chain K (length=322) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELM
QKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLR
EVLKKYGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNE
SKTILKLCDFGSASHVADNDITPYLVSRFYRAPEIIIGKSYDYGIDMWSV
GCTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPNKMIRKGVFKDQHFDQ
NLNFMYIEVDREKVTVMSTINPTKDLLADLILPEDQRKKVHQLKDLLDQI
LMLDPAKRISINQALQHAFIQE
Ligand information
>6qx9 Chain 6 (length=53) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuggaaaagauuagcauggccccugcgcaaggaugacuucgugaagcgau
uuu
..................................................
...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qx9 Mechanism of 5' splice site transfer for human spliceosome activation.
Resolution3.28 Å
Binding residue
(original residue number in PDB)		K911 K915
Binding residue
(residue number reindexed from 1)		K236 K240
Enzymatic activity
Catalytic site (original residue number in PDB) D815 K817 N820 D834 S852
Catalytic site (residue number reindexed from 1) D140 K142 N145 D159 S177
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0044024 histone H2AS1 kinase activity
GO:0106310 protein serine kinase activity
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006338 chromatin remodeling
GO:0006397 mRNA processing
GO:0006468 protein phosphorylation
GO:0008380 RNA splicing
GO:0016310 phosphorylation
GO:0035332 positive regulation of hippo signaling
GO:0045292 mRNA cis splicing, via spliceosome
GO:0046827 positive regulation of protein export from nucleus
GO:0090266 regulation of mitotic cell cycle spindle assembly checkpoint
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005694 chromosome
GO:0016607 nuclear speck
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6qx9, PDBe:6qx9, PDBj:6qx9
PDBsum6qx9
PubMed30975767
UniProtQ13523|PRP4K_HUMAN Serine/threonine-protein kinase PRP4 homolog (Gene Name=PRP4K)

[Back to BioLiP]