Structure of PDB 6qsz Chain K Binding Site BS01

Receptor Information
>6qsz Chain K (length=114) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSKSSWRQEWLANLKLISVSLVDEFPSELSDSDRQIINEKMQLLKDIFAN
NLKSAISNNFRESDIIILKGEIEDYPMSSEIKIYYNELQNKKKARFWSFM
KTQRFVSNMGFDIQ
Ligand information
>6qsz Chain B (length=9) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TDLPSDPPS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qsz The Sir4 H-BRCT domain interacts with phospho-proteins to sequester and repress yeast heterochromatin.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		D1083 Q1085
Binding residue
(residue number reindexed from 1)		D112 Q114
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6qsz, PDBe:6qsz, PDBj:6qsz
PDBsum6qsz
PubMed31515872
UniProtP11978|SIR4_YEAST Regulatory protein SIR4 (Gene Name=SIR4)

[Back to BioLiP]