Structure of PDB 6qem Chain K Binding Site BS01

Receptor Information
>6qem Chain K (length=239) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKNVGDLMQRLQKMMPAHIKPAFKTGEELLAWQKEQGAIRSAALERENRA
MKMQRTFNRSGIRPLHQNCSFENYRVECEGQMNALSKARQYVEEFDGNIA
SFIFSGKPGTGKNHLAAAICNELLLRGKSVLIITVADIMSAMKDTFRNSG
TSEEQLLNDLSNVDLLVIDEIGVQTESKYEKVIINQIVDRRSSSKRPTGM
LTNSNMEEMTKLLGERVMDRMRLGNSLWVIFNWDSYRSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qem Physical Basis for the Loading of a Bacterial Replicative Helicase onto DNA.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		F146 Y179
Binding residue
(residue number reindexed from 1)		F146 Y179
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
Biological Process
GO:0006260 DNA replication
GO:0006268 DNA unwinding involved in DNA replication
GO:0006269 DNA replication, synthesis of primer
GO:0006270 DNA replication initiation
GO:0006271 DNA strand elongation involved in DNA replication
GO:0031297 replication fork processing
Cellular Component
GO:1990077 primosome complex
GO:1990100 DnaB-DnaC complex
GO:1990158 DnaB-DnaC-DnaT-PriA-PriB complex
GO:1990159 DnaB-DnaC-DnaT-PriA-PriC complex
GO:1990160 DnaB-DnaC-Rep-PriC complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6qem, PDBe:6qem, PDBj:6qem
PDBsum6qem
PubMed30797687
UniProtP0AEF0|DNAC_ECOLI Replicative helicase loader DnaC (Gene Name=dnaC)

[Back to BioLiP]