Structure of PDB 6om7 Chain K Binding Site BS01

Receptor Information
>6om7 Chain K (length=208) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHM
VSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKM
LSADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRA
KFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPNRGP
LDKWRALH
Ligand information
>6om7 Chain E (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcu
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6om7 Structural basis for selective stalling of human ribosome nascent chain complexes by a drug-like molecule.
Resolution3.7 Å
Binding residue
(original residue number in PDB)
Y11 E56 N202 R203 G204 P205 L206
Binding residue
(residue number reindexed from 1)
Y9 E54 N197 R198 G199 P200 L201
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0045182 translation regulator activity
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0043066 negative regulation of apoptotic process
GO:1990403 embryonic brain development
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005790 smooth endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0032991 protein-containing complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6om7, PDBe:6om7, PDBj:6om7
PDBsum6om7
PubMed31160784
UniProtP27635|RL10_HUMAN Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]