Structure of PDB 6o1m Chain K Binding Site BS01

Receptor Information
>6o1m Chain K (length=65) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMV
YKHAISTVVPSRPVR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o1m Architectural principles for Hfq/Crc-mediated regulation of gene expression.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		Y25 I30 N48 Q52 T61
Binding residue
(residue number reindexed from 1)		Y21 I26 N44 Q48 T57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6o1m, PDBe:6o1m, PDBj:6o1m
PDBsum6o1m
PubMed30758287
UniProtQ9HUM0|HFQ_PSEAE RNA-binding protein Hfq (Gene Name=hfq)

[Back to BioLiP]