Structure of PDB 6n7x Chain K Binding Site BS01

Receptor Information
>6n7x Chain K (length=124) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KIQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEER
VPKTQLDKLRPRTLNIKVEKRVLGLTILRGEQILSTVVEDKPLLSKKERL
VRDKKEKKQAQKQTKLRKEKEKKP
Ligand information
>6n7x Chain R (length=308) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uaagauaucagaggaaaguccucugaucaaacaugcgcuuccaauaguag
aaggacguuaagcauuuaucauugaacuaguucauugaagucauugaugc
aaacuccuuggucacacacggcgcggaaggcguguuugcugacguuccau
ucccuuguuucaaucauugguuaacugauuuuuggggcccuuuguuucuu
cugccuggagaaguuugacaccaaauauugguguuaggggagcuggggcc
uuucaaaauuuuggaaggucuugguaggaacggguggaucuuauaauuuu
ugauuuau
<<<<<.<<<<<<<<.....>>>>>>>><<<<<<<<<.<<<<<........
<<<<<.<<<..<<<<.<.<<<.<<<<<..>>>>>.>>>.......>>>>>
.>>>>>>>>...............>>>>>>>>>>>>>><<<.<<<<<<..
<<<<<.<<<<<<<..<<<<<<..>>>>>>..>>>>>>>((.......<<<
<<....))>>>>>...<<<<<<<<...>>>>>>>>.>>>>><<<<<<<<<
<<<<<<<<>>>>>>>>>>>>>>>>>.>>>>>>..>>>.>>>>>.......
........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6n7x CryoEM structure of Saccharomyces cerevisiae U1 snRNP offers insight into alternative splicing.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		H8 H40 T56 Q57 K60 R88 K105 K117 Q120 K121 E128
Binding residue
(residue number reindexed from 1)		H6 H38 T54 Q55 K58 R79 K96 K108 Q111 K112 E119
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0070990 snRNP binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000387 spliceosomal snRNP assembly
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0036261 7-methylguanosine cap hypermethylation
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005685 U1 snRNP
GO:0005686 U2 snRNP
GO:0005687 U4 snRNP
GO:0005737 cytoplasm
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071001 U4/U6 snRNP
GO:0071004 U2-type prespliceosome
GO:0071013 catalytic step 2 spliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n7x, PDBe:6n7x, PDBj:6n7x
PDBsum6n7x
PubMed29051543
UniProtP40018|RSMB_YEAST Small nuclear ribonucleoprotein-associated protein B (Gene Name=SMB1)

[Back to BioLiP]