Structure of PDB 6kco Chain K Binding Site BS01

Receptor Information
>6kco Chain K (length=80) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASYSIGDLVFAKVKGYPPWPAKITKSNKKYNVYFYGTGETANIKLEDLFP
YASNKERFATEKIMKRAKFIEAIDQIESAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kco Shuguo PWWP in complex with ssDNA
Resolution2.4 Å
Binding residue
(original residue number in PDB)		V20 K21 Y23 W26 K38 F43 T46 E48 A50 N51 I52 K53
Binding residue
(residue number reindexed from 1)		V13 K14 Y16 W19 K29 F34 T37 E39 A41 N42 I43 K44
Enzymatic activity
Enzyme Commision number ?
External links