Structure of PDB 6exn Chain K Binding Site BS01

Receptor Information
>6exn Chain K (length=170) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDQIAKNVKLDDFIPKRQSNFELSVPLPTKAEIQECTARTKSYIQRLVNA
KLANSNNRASSRYVTANLLLNNSHHIEVVSKQMDPLLPRFVGKKARKVVA
PTENDEVVPVLHMDPNEWKIPAAVSNWKNPNGYTVALERRVTINDGFMKL
SEALENADKKARQEIRSKME
Ligand information
>6exn Chain 2 (length=136) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaaucucuuugccuuuuggcuuagaucaaguguaguaucuguucuuugua
acauguuacaauaccauuuuuuggcaggacgggaagaggagacgucgcga
cccucgcaggucgcuugauguuucuucuucccguuc
..............................................<<<<
<<<>>>>>>>................<<<<<<<<<<<.<<<<<<<<<<<<
.<<.....>>>>>>..>>>>>>>>.>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6exn Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		A168 K173 N174 P175 N176 Y178 R185
Binding residue
(residue number reindexed from 1)		A123 K128 N129 P130 N131 Y133 R140
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000384 first spliceosomal transesterification activity
GO:0000386 second spliceosomal transesterification activity
GO:0005515 protein binding
Biological Process
GO:0000350 generation of catalytic spliceosome for second transesterification step
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071014 post-mRNA release spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6exn, PDBe:6exn, PDBj:6exn
PDBsum6exn
PubMed29146871
UniProtP28004|PRP45_YEAST Pre-mRNA-processing protein 45 (Gene Name=PRP45)

[Back to BioLiP]