Structure of PDB 6c0f Chain K Binding Site BS01

Receptor Information
>6c0f Chain K (length=260) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AIPRERVIKAVNELIKFTSKPKNLLEDDEEELKKDLQLIVVNNKSFTGTS
KSFKLKLLNVKHSFYKPWKEASATAVKDFKVLLILKDSDIKKVSEDDLFD
QLDSEGIKVDEIICGKDLKTVYKAYEARNAFISQFSLILADDSIVTSLPK
LMGGKAYNKVETTPISIRTHANKEFSLTTLTNNIKKVYMNQLPVKLPRGT
TLNVHLGNLEWLRPEEFVDNVELISEQLIKAYQIRSIFIKTNRSPVLPLY
YNQDVLDELE
Ligand information
>6c0f Chain 6 (length=87) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccuucucaaacauucuguuugguagugagugauacucuuuggaguuaacu
ugaaauugcuggccuuuaggcgaacaauguucuuaaa
......<<<<<.....>>>>>.....<<<<...<<<<....>>>>..>>>
>..........<<<<..>>>>................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6c0f Modular assembly of the nucleolar pre-60S ribosomal subunit.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		E71 K75 N84 K93 F95 K96 K128 K161 K165 A166 Y167 E168 D184 S185 I186 V187 T188 S189 P191 K192 L193 G195 G196 Y199 N200 K201 A213 N214 T220 T221 N224 K228 K237 P239 R240 G241 T242 T243 N245 H247 R277 F280 K282 N284 R285 S286 P287
Binding residue
(residue number reindexed from 1)		E29 K33 N42 K51 F53 K54 K86 K119 K123 A124 Y125 E126 D142 S143 I144 V145 T146 S147 P149 K150 L151 G153 G154 Y157 N158 K159 A171 N172 T178 T179 N182 K186 K195 P197 R198 G199 T200 T201 N203 H205 R235 F238 K240 N242 R243 S244 P245
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0070180 large ribosomal subunit rRNA binding
GO:0070628 proteasome binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0030163 protein catabolic process
GO:0042254 ribosome biogenesis
Cellular Component
GO:0000502 proteasome complex
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6c0f, PDBe:6c0f, PDBj:6c0f
PDBsum6c0f
PubMed29512650
UniProtP38779|CIC1_YEAST Proteasome-interacting protein CIC1 (Gene Name=CIC1)

[Back to BioLiP]