Structure of PDB 6ama Chain K Binding Site BS01

Receptor Information
>6ama Chain K (length=54) Species: 54571 (Streptomyces venezuelae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPLLTPAEVATMFRVDPKTVTRWAKAGKLTSIRTLGGHRRYREAEVRALL
AGIP
Ligand information
>6ama Chain N (length=99) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tacccgaattacccgaattacccgaattacccgaattacccgaattaccc
gaattacccgaattacccgaattacccgaattacccgaattacccgaat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ama The MerR-like protein BldC binds DNA direct repeats as cooperative multimers to regulate Streptomyces development.
Resolution3.09 Å
Binding residue
(original residue number in PDB)		V23 D24 K26 T27 R30 W31 T42 G44 H46
Binding residue
(residue number reindexed from 1)		V15 D16 K18 T19 R22 W23 T34 G36 H38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ama, PDBe:6ama, PDBj:6ama
PDBsum6ama
PubMed29556010
UniProtF2REK9

[Back to BioLiP]