Structure of PDB 5ylz Chain K Binding Site BS01

Receptor Information

>5ylz Chain K (length=96) Species: 559292 (Saccharomyces cerevisiae S288C)

DQLAKLSYEKTLRNLATQTQNSSKQDKVQKDTKTGKITIADDDKLVNKLA
VSLQSESKKRYEARKRQMQNAKTLYGVESFINDKNKQFNEKLSRES

Ligand information

>5ylz Chain D (length=103)

guucgcgaaguaacccuucguggacauuuggucaauuugaaacaauacag
agaugaucagcaguuccccugcauaaggaugaaccguuuuacaaagagau
uua

<<<<<<<<<<.....>>>>>>>>>>.........................
............<<<..<<<.....>>>...>>>................
...

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5ylz Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
• Resolution: 3.6 Å
• Binding residue (original residue number in PDB): S104 K107 R175 Y176 R179
• Binding residue (residue number reindexed from 1): S7 K10 R60 Y61 R64

Gene Ontology

Molecular Function

• GO:0000384 first spliceosomal transesterification activity
• GO:0000386 second spliceosomal transesterification activity
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0000974 Prp19 complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005829 cytosol
• GO:0071004 U2-type prespliceosome
• GO:0071006 U2-type catalytic step 1 spliceosome
• GO:0071007 U2-type catalytic step 2 spliceosome
• GO:0071008 U2-type post-mRNA release spliceosomal complex

External links

• PDB: RCSB:5ylz, PDBe:5ylz, PDBj:5ylz
• PDBsum: 5ylz
• PubMed: 29153833
• UniProt: P53277|SYF2_YEAST Pre-mRNA-splicing factor SYF2 (Gene Name=SYF2)