Structure of PDB 5nl0 Chain K Binding Site BS01

Receptor Information
>5nl0 Chain K (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>5nl0 Chain S (length=96) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tacgtaatattggccagctaggatatcacaatcccggtgccgaggccgct
caattggtcgtagacagctctagcaccgcttaaacgcacgtacgga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nl0 Structure and Dynamics of a 197 bp Nucleosome in Complex with Linker Histone H1.
Resolution5.4 Å
Binding residue
(original residue number in PDB)		R42 R72 R83 F84 Q85 R116 V117 T118 M120
Binding residue
(residue number reindexed from 1)		R5 R35 R46 F47 Q48 R79 V80 T81 M83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5nl0, PDBe:5nl0, PDBj:5nl0
PDBsum5nl0
PubMed28475873
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]