Structure of PDB 5lf6 Chain K Binding Site BS01

Receptor Information

>5lf6 Chain K (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAA
DCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTM
ICGWDKRGPGLYYVDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVE
QAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYS

Ligand information

>5lf6 Chain c (length=3) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

LLc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5lf6 The inhibition mechanism of human 20S proteasomes enables next-generation inhibitor design.
Resolution	2.07 Å
Binding residue (original residue number in PDB)	T5 A24 T25 V35 K37 G51 A53 Y173
Binding residue (residue number reindexed from 1)	T1 A20 T21 V31 K33 G47 A49 Y169

Enzymatic activity

Enzyme Commision number

3.4.25.1: proteasome endopeptidase complex.

Gene Ontology

	Molecular Function
GO:0004298	threonine-type endopeptidase activity

	Biological Process
GO:0051603	proteolysis involved in protein catabolic process

	Cellular Component
GO:0005839	proteasome core complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5lf6, PDBe:5lf6, PDBj:5lf6
PDBsum	5lf6
PubMed	27493187
UniProt	P28074\|PSB5_HUMAN Proteasome subunit beta type-5 (Gene Name=PSMB5)

[Back to BioLiP]