Structure of PDB 5gap Chain K Binding Site BS01

Receptor Information
>5gap Chain K (length=124) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFI
IMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASI
TTNDASAIKTQIYAVKDKIETLLI
Ligand information
>5gap Chain V (length=67) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auccuuaugcacgggaaauacgcauaucagugaggauucguccgagauug
uguuuuugcugguugaa
...................<<<<<.<<<.....<<<....>>>..>>>>>
>>>..............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5gap Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		Q26 N29 K34 K35 G36 A37 N38 E39 K42 R46 E59 I63 V93 R95 V97 I98
Binding residue
(residue number reindexed from 1)		Q24 N27 K32 K33 G34 A35 N36 E37 K40 R44 E57 I61 V91 R93 V95 I96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030621 U4 snRNA binding
GO:0034511 U3 snoRNA binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0000452 snoRNA guided rRNA 2'-O-methylation
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000494 box C/D sno(s)RNA 3'-end processing
GO:0006364 rRNA processing
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005687 U4 snRNP
GO:0005730 nucleolus
GO:0031428 box C/D methylation guide snoRNP complex
GO:0032040 small-subunit processome
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071001 U4/U6 snRNP
GO:0071011 precatalytic spliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gap, PDBe:5gap, PDBj:5gap
PDBsum5gap
PubMed26829225
UniProtP39990|SNU13_YEAST 13 kDa ribonucleoprotein-associated protein (Gene Name=SNU13)

[Back to BioLiP]