Structure of PDB 5g04 Chain K Binding Site BS01

Receptor Information
>5g04 Chain K (length=493) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTA
QYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLSIKSSICL
LRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKEL
LESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVV
VSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANEL
FYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYG
PAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNS
KLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKA
IGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSA
IGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYI
Ligand information
>5g04 Chain W (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MLRRKPTRLELKLDDIEEFENIRKD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5g04 Molecular Mechanism of Apc/C Activation by Mitotic Phosphorylation.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		Y242 Y243 C245 F247 E277 I338 A339 H342 A345 L369 Y373 L376 F403 H406 F413 K443 W444 E445 P446 N449 N450 H453 R456 S480 A484 Y487 F495 F514 M518 H521 E524 M525
Binding residue
(residue number reindexed from 1)		Y208 Y209 C211 F213 E243 I304 A305 H308 A311 L335 Y339 L342 F369 H372 F379 K409 W410 E411 P412 N415 N416 H419 R422 S446 A450 Y453 F461 F480 M484 H487 E490 M491
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0007346 regulation of mitotic cell cycle
GO:0016567 protein ubiquitination
GO:0031145 anaphase-promoting complex-dependent catabolic process
GO:0045842 positive regulation of mitotic metaphase/anaphase transition
GO:0051301 cell division
GO:0051445 regulation of meiotic cell cycle
GO:0070936 protein K48-linked ubiquitination
GO:0070979 protein K11-linked ubiquitination
GO:0141198 protein branched polyubiquitination
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005680 anaphase-promoting complex
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005819 spindle
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0072686 mitotic spindle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5g04, PDBe:5g04, PDBj:5g04
PDBsum5g04
PubMed27120157
UniProtQ13042|CDC16_HUMAN Cell division cycle protein 16 homolog (Gene Name=CDC16)

[Back to BioLiP]