Structure of PDB 5ft1 Chain K Binding Site BS01

Receptor Information
>5ft1 Chain K (length=240) Species: 169683 (Phikzvirus phiKZ) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QFNITWEEQLQALSKLDGLHHPHKLEDISVHWFNPVDIVFVTCATMSSHN
THYTFKPQSSPDDAMVREYVLSRIIADNLKYVDNLYLAAGAVICGNDEYI
SDGNVVGIHLILPVIEFMPGVHVDDISDKLIKSSSYQGIFKTDNLEEFEF
LVDKNANNVKELILAYTDYFANKLAFKDPAEPAVEMYQFIDRTEVYFSFE
GCHPDVEEVLFTIKIVRYNQPLMQVFNPLLSHIRTVVRQD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5ft1 Structural elucidation of a novel mechanism for the bacteriophage-based inhibition of the RNA degradosome.
Resolution2.75 Å
Binding residue
(original residue number in PDB)
D138 E195 A197 E199 E214 E222
Binding residue
(residue number reindexed from 1)
D125 E181 A183 E185 E200 E208
Enzymatic activity
Enzyme Commision number ?
External links