Structure of PDB 5dqt Chain K Binding Site BS01

Receptor Information

>5dqt Chain K (length=278) Species: 83333 (Escherichia coli K-12)

TWLPLNPIPLKDRVSMIFLQYGQIDVIDGAFVLIDKTGIRTHIPVGSVAC
IMLEPGTRVSHAAVRLAAQVGTLLVWVGEAGVRVYASGQPGGARSDKLLY
QAKLALDEDLRLKVVRKMFELRFGEPAPARRSVEQLRGIEGSRVRATYAL
LAKQYGVTWNGRRYDPKDWEKGDTINQCISAATSCLYGVTEAAILAAGYA
PAIGFVHTGKPLSFVYDIADIIKFDTVVPKAFEIARRNPGEPDREVRLAC
RDIFRSSKTLAKLIPLIEDVLAAGEIQP

Ligand information

>5dqt Chain G (length=33)

tttttcgtagctgagttgagtcgatgctttttt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5dqt Structural and Mechanistic Basis of PAM-Dependent Spacer Acquisition in CRISPR-Cas Systems.
• Resolution: 3.1 Å
• Binding residue (original residue number in PDB): V83 R84 R146 G162 R163 R164 Y165 P167 S181 T184 S185 Y188 Y217
• Binding residue (residue number reindexed from 1): V82 R83 R145 G161 R162 R163 Y164 P166 S180 T183 S184 Y187 Y216

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0004520 DNA endonuclease activity
• GO:0005515 protein binding
• GO:0008821 crossover junction DNA endonuclease activity
• GO:0017108 5'-flap endonuclease activity
• GO:0042802 identical protein binding
• GO:0042803 protein homodimerization activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0043571 maintenance of CRISPR repeat elements
• GO:0051607 defense response to virus
• GO:0099048 CRISPR-cas system

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5dqt, PDBe:5dqt, PDBj:5dqt
• PDBsum: 5dqt
• PubMed: 26478180
• UniProt: Q46896|CAS1_ECOLI CRISPR-associated endonuclease Cas1 (Gene Name=ygbT)