Structure of PDB 5dpw Chain K Binding Site BS01

Receptor Information
>5dpw Chain K (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPFKQRKSLAIRQEEVAGIRAKFPNKIPVVVERYPRETFLPPLDKTKFLV
PQELTMTQFLSIIRSRMVLRATEAFYLLVNNKSLVSMSATMAEIYRDYKD
EDGFVYMTYASQETF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5dpw Structural and functional analysis of the GABARAP interaction motif (GIM).
Resolution2.185 Å
Binding residue
(original residue number in PDB)		R6 K7 I19 K26 P28 K45 K47 F48 L49 P51 L54 F104
Binding residue
(residue number reindexed from 1)		R6 K7 I19 K26 P28 K45 K47 F48 L49 P51 L54 F104
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Biological Process
External links
PDB RCSB:5dpw, PDBe:5dpw, PDBj:5dpw
PDBsum5dpw
PubMed28655748
UniProtQ9BXW4|MLP3C_HUMAN Microtubule-associated proteins 1A/1B light chain 3C (Gene Name=MAP1LC3C)

[Back to BioLiP]