Structure of PDB 4z88 Chain K Binding Site BS01

Receptor Information
>4z88 Chain K (length=66) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFRYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGE
LRGRRGYVPHNMVSEV
Ligand information
>4z88 Chain W (length=12) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RRKLPEIPKNKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4z88 A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		F1324 Y1326 P1333 N1334 D1359 F1361 Y1372 P1374
Binding residue
(residue number reindexed from 1)		F9 Y11 P18 N19 D44 F46 Y57 P59
Enzymatic activity
Enzyme Commision number ?
External links