Structure of PDB 4y8p Chain K Binding Site BS01

Receptor Information

>4y8p Chain K (length=212) Species: 559292 (Saccharomyces cerevisiae S288C)

TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAA
DCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTM
ICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSV
EDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKV
KEEEGSFNNVIG

Ligand information

>4y8p Chain d (length=3) Species: 32630 (synthetic construct)

PAL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4y8p Systematic Analyses of Substrate Preferences of 20S Proteasomes Using Peptidic Epoxyketone Inhibitors.
• Resolution: 2.8 Å
• Binding residue (original residue number in PDB): T1 T21 K33 G47 A49
• Binding residue (residue number reindexed from 1): T1 T21 K33 G47 A49

Enzymatic activity

• Catalytic site (original residue number in PDB): T1 D17 R19 K33 G47 S131 D168 S171
• Catalytic site (residue number reindexed from 1): T1 D17 R19 K33 G47 S131 D168 S171
• Enzyme Commision number: 3.4.25.1: proteasome endopeptidase complex.

Gene Ontology

Molecular Function

• GO:0004298 threonine-type endopeptidase activity

Biological Process

• GO:0051603 proteolysis involved in protein catabolic process

Cellular Component

• GO:0005839 proteasome core complex

External links

• PDB: RCSB:4y8p, PDBe:4y8p, PDBj:4y8p
• PDBsum: 4y8p
• PubMed: 26020686
• UniProt: P30656|PSB5_YEAST Proteasome subunit beta type-5 (Gene Name=PRE2)