Structure of PDB 4ui9 Chain K Binding Site BS01

Receptor Information
>4ui9 Chain K (length=493) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTA
QYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLSIKSSICL
LRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKEL
LESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLEKNLDVV
VSLAERHYYNCDFKMCYKLTSVVMEKDPFHKSCLPVHIGTLVELNKANEL
FYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYG
PAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNS
KLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKA
IGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSA
IGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYI
Ligand information
>4ui9 Chain W (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MLRRKPTRLELKLDDIEEFENIRKD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ui9 Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
Resolution3.6 Å
Binding residue
(original residue number in PDB)		Y242 Y243 A339 H342 A345 L369 Y373 L376 H406 E407 F413 W444 E445 P446 N449 N450 R456 K457 S480 A484 Y487 L491 F514 M518 H521
Binding residue
(residue number reindexed from 1)		Y208 Y209 A305 H308 A311 L335 Y339 L342 H372 E373 F379 W410 E411 P412 N415 N416 R422 K423 S446 A450 Y453 L457 F480 M484 H487
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0007346 regulation of mitotic cell cycle
GO:0016567 protein ubiquitination
GO:0031145 anaphase-promoting complex-dependent catabolic process
GO:0045842 positive regulation of mitotic metaphase/anaphase transition
GO:0051301 cell division
GO:0051445 regulation of meiotic cell cycle
GO:0070936 protein K48-linked ubiquitination
GO:0070979 protein K11-linked ubiquitination
GO:0141198 protein branched polyubiquitination
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005680 anaphase-promoting complex
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005819 spindle
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0072686 mitotic spindle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ui9, PDBe:4ui9, PDBj:4ui9
PDBsum4ui9
PubMed26083744
UniProtQ13042|CDC16_HUMAN Cell division cycle protein 16 homolog (Gene Name=CDC16)

[Back to BioLiP]