Structure of PDB 4pj0 Chain K Binding Site BS01

Receptor Information
>4pj0 Chain K (length=36) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
Ligand information
>4pj0 Chain Y (length=29) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VIAQLTMIAMIGIAGPMIIFLLAVRRGNL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pj0 Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
Resolution2.437 Å
Binding residue
(original residue number in PDB)		L21 V24 W39 V43
Binding residue
(residue number reindexed from 1)		L11 V14 W29 V33
Enzymatic activity
Enzyme Commision number 1.10.3.9: photosystem II.
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pj0, PDBe:4pj0, PDBj:4pj0
PDBsum4pj0
PubMed25438669
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]