Structure of PDB 4nl3 Chain K Binding Site BS01

Receptor Information
>4nl3 Chain K (length=73) Species: 1639 (Listeria monocytogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNFTVLLDVE
GKQQLVFKHAISTFSPQKNVALN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4nl3 Recognition of U-rich RNA by Hfq from the Gram-positive pathogen Listeria monocytogenes.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Q6 Q9 N42 F43 K58 H59
Binding residue
(residue number reindexed from 1)		Q6 Q9 N42 F43 K58 H59
Binding affinityPDBbind-CN: Kd=3.4uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0043487 regulation of RNA stability
GO:0045974 regulation of translation, ncRNA-mediated
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4nl3, PDBe:4nl3, PDBj:4nl3
PDBsum4nl3
PubMed25150227
UniProtQ92C58

[Back to BioLiP]