Structure of PDB 4ixr Chain K Binding Site BS01

Receptor Information
>4ixr Chain K (length=37) Species: 146786 (Thermosynechococcus vestitus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
Ligand information
>4ixr Chain y (length=28) Species: 146786 (Thermosynechococcus vestitus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IAQLTMIAMIGIAGPMIIFLLAVRRGNL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ixr Simultaneous femtosecond X-ray spectroscopy and diffraction of photosystem II at room temperature.
Resolution5.9 Å
Binding residue
(original residue number in PDB)		P20 D23 V24 L35 R46
Binding residue
(residue number reindexed from 1)		P11 D14 V15 L26 R37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009523 photosystem II
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ixr, PDBe:4ixr, PDBj:4ixr
PDBsum4ixr
PubMed23413188
UniProtQ9F1K9|PSBK_THEVB Photosystem II reaction center protein K (Gene Name=psbK)

[Back to BioLiP]