Structure of PDB 4d69 Chain K Binding Site BS01

Receptor Information

>4d69 Chain K (length=232) Species: 3847 (Glycine max) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AETVSFSWNKFVPKQPNMILQGDAIVTSSGKLQLNKVDENGTPKPSSLGR
ALYSTPIHIWDKETGSVASFAASFNFTFYAPDTKRLADGLAFFLAPIDTK
PQTHAGYLGLFNENEDQVVAVEFDTFRNSWDPPNPHIGINVNSIRSIKTT
SWDLANNKVAKVLITYDASTSLLVASLVYPSQRTSNILSDVVDLKTSLPE
WVRIGFSAATGLDIPGESHDVLSWSFASNLPH

Ligand information

>4d69 Chain Y (length=3) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DTR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4d69 Detection of Tumor-Associated Glycopeptides by Lectins: The Peptide Context Modulates Carbohydrate Recognition.
Resolution	2.7 Å
Binding residue (original residue number in PDB)	E113 N130 S131 L214
Binding residue (residue number reindexed from 1)	E113 N128 S129 L212

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0030246	carbohydrate binding

View graph for
Molecular Function

External links

PDB	RCSB:4d69, PDBe:4d69, PDBj:4d69
PDBsum	4d69
PubMed	25457745
UniProt	P05046\|LEC_SOYBN Lectin (Gene Name=LE1)

[Back to BioLiP]