Structure of PDB 4cc7 Chain K Binding Site BS01

Receptor Information
>4cc7 Chain K (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEWWLAEVNGKKG
YVPSNYIRKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4cc7 Structural Details of Human Tuba Recruitment by Inlc of Listeria Monocytogenes Elucidate Bacterial Cell-Cell Spreading.
Resolution1.97 Å
Binding residue
(original residue number in PDB)
N1530 Y1565
Binding residue
(residue number reindexed from 1)
N16 Y51
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4cc7, PDBe:4cc7, PDBj:4cc7
PDBsum4cc7
PubMed24332715
UniProtQ6XZF7|DNMBP_HUMAN Dynamin-binding protein (Gene Name=DNMBP)

[Back to BioLiP]