Structure of PDB 4by9 Chain K Binding Site BS01

Receptor Information

>4by9 Chain K (length=227) Species: 2261 (Pyrococcus furiosus)

MVEVKKHKFPGVYVVIDDDGSEKIATKNLVPGQRVYGERVIKWEGEEYRI
WNPHRSKLGAAIVNGLKNFPIKPGKSVLYLGIASGTTASHVSDIVGWEGK
IYGIEFSPRVLRELVPIVEERRNIIPILGDATKPEEYRALVTKVDVIFED
VAQPTQAKILIDNAKAYLKRGGYGMIAVKSRSIDVTKEPEQVFKEVEREL
SEYFEVIERLNLEPYEKDHALFVVRKP

Ligand information

>4by9 Chain B (length=72)

gcgagcaaugaugagugaugggcgaacugagcucgaaagagcaaugauga
gugaugggcgaacugagcucgc

<<<<<<....<...................<<<<....>>>>........
.............>..>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4by9 The Structure of the Box C/D Enzyme Reveals Regulation of RNA Methylation.
• Resolution: N/A
• Binding residue (original residue number in PDB): H54 R109 Q153 P154 V185
• Binding residue (residue number reindexed from 1): H54 R109 Q153 P154 V185

Enzymatic activity

• Enzyme Commision number: 2.1.1.-

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0008649 rRNA methyltransferase activity
• GO:0016740 transferase activity
• GO:1990259 histone H2AQ104 methyltransferase activity

Biological Process

• GO:0000494 box C/D sno(s)RNA 3'-end processing
• GO:0006338 chromatin remodeling
• GO:0006364 rRNA processing
• GO:0008033 tRNA processing
• GO:0031167 rRNA methylation
• GO:0032259 methylation

Cellular Component

• GO:0031428 box C/D methylation guide snoRNP complex

External links

• PDB: RCSB:4by9, PDBe:4by9, PDBj:4by9
• PDBsum: 4by9
• PubMed: 24121435
• UniProt: Q8U4M2|FLPA_PYRFU Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase (Gene Name=flpA)