Structure of PDB 3u5z Chain K Binding Site BS01

Receptor Information
>3u5z Chain K (length=186) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLFKDDIQLNEHQVAWYSKDWTAVQSAADSFKEKAENEFFEIIGAINNKT
KCSIAQKDYSKFMVENALSQFPECMPAVYAMNLIGSGLSDEAHFNYLMAA
VPRGKRYGKWAKLVEDSTEVLIIKLLAKRYQVNTNDAINYKSILTKNGKL
PLVLKELKGLVTDDFLKEVTKNVKEQKQLKKLALEW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3u5z How a DNA polymerase clamp loader opens a sliding clamp.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		N38 F41 F63 M64 Y108 G109 W111
Binding residue
(residue number reindexed from 1)		N37 F40 F62 M63 Y107 G108 W110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003689 DNA clamp loader activity
Biological Process
GO:0006260 DNA replication
GO:0039686 bidirectional double-stranded viral DNA replication
GO:0039693 viral DNA genome replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3u5z, PDBe:3u5z, PDBj:3u5z
PDBsum3u5z
PubMed22194570
UniProtP04527|LOADS_BPT4 Sliding-clamp-loader small subunit (Gene Name=62)

[Back to BioLiP]