Structure of PDB 3t5q Chain K Binding Site BS01

Receptor Information
>3t5q Chain K (length=294) Species: 300180 (Mopeia Lassa virus reassortant 29) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSFLWTQSLRRELSGYCSNIKLQVVKDAQALLHGLDFSEVSNVQRLMRKE
RRDDNDLKRLRDLNQAVNNLVELKSTQQKSILRVGTLTSDDLLILAADLE
KLKSNLSSQQLDQRRALLNMIGDVKNAELLSNQFGTMPSLTLACLTKQGQ
VDLNDAVQALTDLGLIYTAKYPNTSDLDRLTQSHPILNMIDTKKSSLNIS
GYNFSLGAAVKAGACMLDGGNMLETIKVSPQTMDGILKSILKVKKALGMF
ISDTPGERNPYENILYKICLSGDGWPYIASRTSITGRAWENTVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3t5q Crystal structure of the Lassa virus nucleoprotein-RNA complex reveals a gating mechanism for RNA binding.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R59 N174 F176 G177 T178 N215 T216 S237 S238 L239 N240 S247 L248 K253 R300 Y308 K309 R323 R329
Binding residue
(residue number reindexed from 1)		R52 N132 F134 G135 T136 N173 T174 S195 S196 L197 N198 S205 L206 K211 R258 Y266 K267 R281 R287
Enzymatic activity
Enzyme Commision number 3.1.13.-
External links