Structure of PDB 3stj Chain K Binding Site BS01

Receptor Information

>3stj Chain K (length=300) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PLPSLAPMLEKVLPAVVSVRVEGTQPFEGLGSGVIINASKGYVLTNNHVI
NQAQKISIQLNDGREFDAKLIGSDDQSDIALLQIQNPSKLTQIAIADSDK
LRVGDFAVAVGNPFGLGQTATSGIVSALGRSGLNLEGLENFIQTDASINR
GNSGGALLNLNGELIGINTAILAPGGGSVGIGFAIPSNMARTLAQQLIDF
GEIKRGLLGIKGTEMSADIAKAFNLDVQRGAFVSEVLPGSGSAKAGVKAG
DIITSLNGKPLNSFAELRSRIATTEPGTKVKLGLLRNGKPLEVEVTLDTS

Ligand information

>3stj Chain W (length=5) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAAAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3stj Molecular adaptation of the DegQ protease to exert protein quality control in the bacterial cell envelope.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	L241 L242 I244 G246 F298
Binding residue (residue number reindexed from 1)	L207 L208 I210 G212 F264

Enzymatic activity

Enzyme Commision number

3.4.21.107: peptidase Do.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3stj, PDBe:3stj, PDBj:3stj
PDBsum	3stj
PubMed	21685389
UniProt	P39099\|DEGQ_ECOLI Periplasmic pH-dependent serine endoprotease DegQ (Gene Name=degQ)

[Back to BioLiP]