Structure of PDB 3nzx Chain K Binding Site BS01

Receptor Information

>3nzx Chain K (length=212) Species: 4932 (Saccharomyces cerevisiae)

TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAA
DCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTM
ICGYTRKEGPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSV
EDALYLGKRSILAAAHRDAYSGGSVNLYHVTEDGWIYHGNHDVGELFWKV
KEEEGSFNNVIG

Ligand information

>3nzx Chain 3 (length=3)

YAW

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3nzx 20S proteasome inhibition: designing noncovalent linear peptide mimics of the natural product TMC-95A.
• Resolution: 2.7 Å
• Binding residue (original residue number in PDB): A20 T21 G47 G48 A49
• Binding residue (residue number reindexed from 1): A20 T21 G47 G48 A49

Enzymatic activity

• Catalytic site (original residue number in PDB): T1 D17 R19 K33 G47 S129 D166 S169
• Catalytic site (residue number reindexed from 1): T1 D17 R19 K33 G47 S131 D168 S171
• Enzyme Commision number: 3.4.25.1: proteasome endopeptidase complex.

Gene Ontology

Molecular Function

• GO:0004175 endopeptidase activity
• GO:0004298 threonine-type endopeptidase activity
• GO:0005515 protein binding

Biological Process

• GO:0006508 proteolysis
• GO:0010499 proteasomal ubiquitin-independent protein catabolic process
• GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
• GO:0051603 proteolysis involved in protein catabolic process
• GO:0080129 proteasome core complex assembly

Cellular Component

• GO:0000502 proteasome complex
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005777 peroxisome
• GO:0005829 cytosol
• GO:0005839 proteasome core complex
• GO:0019774 proteasome core complex, beta-subunit complex

External links

• PDB: RCSB:3nzx, PDBe:3nzx, PDBj:3nzx
• PDBsum: 3nzx
• PubMed: 20715286
• UniProt: P30656|PSB5_YEAST Proteasome subunit beta type-5 (Gene Name=PRE2)