Structure of PDB 3jcm Chain K Binding Site BS01

Receptor Information
>3jcm Chain K (length=279) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PNLELHEDKFLLDLSKFKIYYDNNHGYEWWDTAYLVAHPLPEKIIKAYLT
QHERKRLRRNRRKMAREAREIKIKLGLLPKPEPKVKLSNMMSVFENDQNI
TDPTAWEKVVKDQVDLRKRKHLEENERRHEDAIKRRKEAVNMNVEKPTVY
HCKVFQFKNLQNPKIRFKLKMNSKELSLKGLCLRIRDDGPGIIIVVGNEK
SCKFYENLVMKRIKWNEDFELHTNTGDIKMDMHNNSISKTWEGYLQDCKF
KGWFMKVCNDQDSLLRTLGQFDSEHFYSP
Ligand information
>3jcm Chain D (length=45) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aauacagagaucagcaguuccccugcauaaggaugaaccguguuu
.............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jcm The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
Resolution3.8 Å
Binding residue
(original residue number in PDB)		K242 R246 R253 K271 N276 N312 R315 P350 K351 R353 F354 K355 K357 M358 E362 R399 E407 H409 F441 M442 K443
Binding residue
(residue number reindexed from 1)		K55 R59 R66 K84 N89 N125 R128 P163 K164 R166 F167 K168 K170 M171 E175 R212 E220 H222 F254 M255 K256
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005687 U4 snRNP
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071001 U4/U6 snRNP

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jcm, PDBe:3jcm, PDBj:3jcm
PDBsum3jcm
PubMed26743623
UniProtQ03338|PRP3_YEAST U4/U6 small nuclear ribonucleoprotein PRP3 (Gene Name=PRP3)

[Back to BioLiP]