Structure of PDB 3d1n Chain K Binding Site BS01

Receptor Information
>3d1n Chain K (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NMEEIREFAKNFKIRRLSLGLTQTQVGQAMTATEGPAYSQSAISRFEKLD
ITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFT
PQAIEALNAYFEKNPLPTGQEITEMAKELNYDREVVRVWFSNRRQTLKNT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3d1n Structure of human Brn-5 transcription factor in complex with CRH gene promoter.
Resolution2.51 Å
Binding residue
(original residue number in PDB)
T194 S197
Binding residue
(residue number reindexed from 1)
T52 S55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3d1n, PDBe:3d1n, PDBj:3d1n
PDBsum3d1n
PubMed19450691
UniProtQ14863|PO6F1_HUMAN POU domain, class 6, transcription factor 1 (Gene Name=POU6F1)

[Back to BioLiP]