Structure of PDB 2vs8 Chain K Binding Site BS01

Receptor Information
>2vs8 Chain K (length=177) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAPL
MQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMRE
QIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDD
HRHGVYVLNISLRDRIKFVHTILSSHL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vs8 Crystal Structure of I-Dmoi in Complex with its Target DNA Provides New Insights Into Meganuclease Engineering.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		K86 Y89 N93 R97
Binding residue
(residue number reindexed from 1)		K81 Y84 N88 R92
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing
GO:0016539 intein-mediated protein splicing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2vs8, PDBe:2vs8, PDBj:2vs8
PDBsum2vs8
PubMed18974222
UniProtP21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]