Structure of PDB 2qux Chain K Binding Site BS01

Receptor Information
>2qux Chain K (length=122) Species: 12023 (Pseudomonas phage PP7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SMSKTIVLSVGEATRTLTEIQSTADRQIFEEKVGPLVGRLRLTASLRQNG
AKTAYRVNLKLDQADVVSGLPKVRYTQVWSHDVTIVANSTEASRKSLYDL
TKSLVATSQVEDLVVNLVPLGR
Ligand information
>2qux Chain L (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcacagaagauauggcuucgugcc
<<<<<.<<<<......>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qux Structural basis for the coevolution of a viral RNA-protein complex.
Resolution2.44 Å
Binding residue
(original residue number in PDB)
R24 R54 K58 D60 Y80 T81 V83 S85 D87 T89
Binding residue
(residue number reindexed from 1)
R26 R56 K60 D62 Y75 T76 V78 S80 D82 T84
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2qux, PDBe:2qux, PDBj:2qux
PDBsum2qux
PubMed18066080
UniProtP03630|CAPSD_BPPP7 Capsid protein

[Back to BioLiP]