Structure of PDB 2om7 Chain K Binding Site BS01

Receptor Information
>2om7 Chain K (length=190) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVYTIDEAARTAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVR
VLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFVMGAVGSKLGRIL
GPRGLNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPE
KLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVR
Ligand information
>2om7 Chain J (length=73) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcucuuggucgcgccugcguaggauaggugggagccuggcgccggugaaa
uccacccuggcgcggcugggggc
<<<<<<<<<<<<<<<...........<<<<<<..................
>>>>>>..>>>>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2om7 Structural basis for interaction of the ribosome with the switch regions of GTP-bound elongation factors.
Resolution7.3 Å
Binding residue
(original residue number in PDB)		K36 T40 E42 H44 K46 I171 T215 T216 T217
Binding residue
(residue number reindexed from 1)		K13 T17 E19 H21 K23 I138 T182 T183 T184
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2om7, PDBe:2om7, PDBj:2om7
PDBsum2om7
PubMed17349960
UniProtQ5SLP7|RL1_THET8 Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]