Structure of PDB 2irf Chain K Binding Site BS01

Receptor Information
>2irf Chain K (length=109) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPL
FRNWAIHTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNN
AFRVYRMLP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2irf Crystal structure of an IRF-DNA complex reveals novel DNA recognition and cooperative binding to a tandem repeat of core sequences.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
W838 H840 A841 K875 K878 R882
Binding residue
(residue number reindexed from 1)
W34 H36 A37 K71 K74 R78
Binding affinityPDBbind-CN: Kd=0.17uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:2irf, PDBe:2irf, PDBj:2irf
PDBsum2irf
PubMed10487755
UniProtP23906|IRF2_MOUSE Interferon regulatory factor 2 (Gene Name=Irf2)

[Back to BioLiP]