Structure of PDB 1ycp Chain K Binding Site BS01

Receptor Information
>1ycp Chain K (length=146) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDI
ALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRE
Ligand information
>1ycp Chain J (length=29) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ADCGLRPLFEKKQVQDQTEKELFESYIEG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ycp Crystal structure of fibrinogen-Aalpha peptide 1-23 (F8Y) bound to bovine thrombin explains why the mutation of Phe-8 to tyrosine strongly inhibits normal cleavage at Arg-16.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		E23 G25 L26 D116 H119 P120 V121 C122 F134 K135 R137
Binding residue
(residue number reindexed from 1)		E8 G10 L11 D113 H116 P117 V118 C119 F134 K135 R137
Enzymatic activity
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ycp, PDBe:1ycp, PDBj:1ycp
PDBsum1ycp
PubMed9307032
UniProtP00735|THRB_BOVIN Prothrombin (Gene Name=F2)

[Back to BioLiP]