Structure of PDB 1f2i Chain K Binding Site BS01

Receptor Information
>1f2i Chain K (length=63) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NYVVPKMRPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFS
RSDHLTTHIRTHT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1f2i Selected peptide extension contacts hydrophobic patch on neighboring zinc finger and mediates dimerization on DNA.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		R5103 R5114 R5118 E5121 R5124 H5125 R5146 H5149
Binding residue
(residue number reindexed from 1)		R8 R19 R23 E26 R29 H30 R51 H54
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1f2i, PDBe:1f2i, PDBj:1f2i
PDBsum1f2i
PubMed11427887
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]