Structure of PDB 1aqd Chain K Binding Site BS01

Receptor Information
>1aqd Chain K (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTEL
GRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYP
SKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDW
TFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1aqd The class II MHC protein HLA-DR1 in complex with an endogenous peptide: implications for the structural basis of the specificity of peptide binding.
Resolution2.45 Å
Binding residue
(original residue number in PDB)
F13 Y47 P56 D57 Y60 W61 L67 Q70 R71 T77 Y78 H81 N82 V85
Binding residue
(residue number reindexed from 1)
F10 Y44 P53 D54 Y57 W58 L64 Q67 R68 T74 Y75 H78 N79 V82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1aqd, PDBe:1aqd, PDBj:1aqd
PDBsum1aqd
PubMed9351812
UniProtP01911|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]