Structure of PDB 1a81 Chain K Binding Site BS01

Receptor Information
>1a81 Chain K (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHG
RKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLVCLLKKPFN
RPQGVQPKTPQLEKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKF
LIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVE
HYSYKADGLLRVLTVPCQKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1a81 Structural basis for Syk tyrosine kinase ubiquity in signal transduction pathways revealed by the crystal structure of its regulatory SH2 domains bound to a dually phosphorylated ITAM peptide.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R22 R42 H62 H63 Y64 G98 L99 R175 R195 R197 L214 H215 Y216 R217 I228 P229 K247 D249 G250 L251 L252
Binding residue
(residue number reindexed from 1)		R14 R34 H54 H55 Y56 G90 L91 R133 R153 R155 L172 H173 Y174 R175 I186 P187 K205 D207 G208 L209 L210
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Gene Ontology
Molecular Function
GO:0004715 non-membrane spanning protein tyrosine kinase activity

View graph for
Molecular Function
External links
PDB RCSB:1a81, PDBe:1a81, PDBj:1a81
PDBsum1a81
PubMed9698567
UniProtP43405|KSYK_HUMAN Tyrosine-protein kinase SYK (Gene Name=SYK)

[Back to BioLiP]