Structure of PDB 5e7k Chain J8 Binding Site BS01

Receptor Information
>5e7k Chain J8 (length=94) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELL
Ligand information
>5e7k Chain 3K (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggucguuagcucaguugguagagcaguugacuuuuaaucaauuggucgc
agguucgaauccugcacgacccacca
<<<<<<...<<<<........>>>>.<<<<<.......>>>>>......<
<<<.......>>>>..>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5e7k Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
Resolution3.2 Å
Binding residue
(original residue number in PDB)
K23 V30
Binding residue
(residue number reindexed from 1)
K22 V29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5e7k, PDBe:5e7k, PDBj:5e7k
PDBsum5e7k
PubMed26791911
UniProtP60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)

[Back to BioLiP]