Structure of PDB 7nz2 Chain J4 Binding Site BS01

Receptor Information
>7nz2 Chain J4 (length=135) Species: 230089 (Photorhabdus thracensis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKYQQLENLECGWKWAYLIRKHQEGEPITKYIENSAAHAAVDKLIKLESE
PVRVLEWIEQHMNPDLFNRMKQTIRARRKRHFNAEHQHTRKKSIDLDFPV
WHRLSALSQRRGNTLSETIVQLIEDAERKEKYANQ
Ligand information
>7nz2 Chain M2 (length=76) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tgccgttacaatgtaacagtggcgggtaatccagagccagacgagcacta
cgaacaactaatgcctactttacagg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nz2 Cryo-EM structure of MukBEF reveals DNA loop entrapment at chromosomal unloading sites.
Resolution11.0 Å
Binding residue
(original residue number in PDB)		M1 Y17 K21 Q72 T73 R77 R80 K92 S93
Binding residue
(residue number reindexed from 1)		M1 Y17 K21 Q72 T73 R77 R80 K92 S93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0051301 cell division
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nz2, PDBe:7nz2, PDBj:7nz2
PDBsum7nz2
PubMed34739874
UniProtA0A0F7LUV5

[Back to BioLiP]