Structure of PDB 8z9c Chain J Binding Site BS01

Receptor Information
>8z9c Chain J (length=198) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPFK
GALRSALEIMLKAKGENVCDTGESRARPCGRCVTCSLFGSMGRAGRASVD
FLISNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITISN
PQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATDRFLK
Ligand information
>8z9c Chain M (length=48) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaaaacucuucucaugcuggauucgaaauuaggugcgcuucgcguu
................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8z9c Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution3.01 Å
Binding residue
(original residue number in PDB)		G21 F37 R40 K52 G53 R56 S57 T73 P80 G91 S92 M93 A96 T118 H119 L120 R121 I122 R124 K127 A129 F133 G174 G175 W176 N178
Binding residue
(residue number reindexed from 1)		G19 F35 R38 K50 G51 R54 S55 T71 P78 G89 S90 M91 A94 T116 H117 L118 R119 I120 R122 K125 A127 F131 G172 G173 W174 N176
External links