Structure of PDB 8z99 Chain J Binding Site BS01

Receptor Information
>8z99 Chain J (length=199) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPF
KGALRSALEIMLKAKGENVCDTGESRARPCGRCVTCSLFGSMGRAGRASV
DFLISNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITIS
NPQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATDRFLK
Ligand information
>8z99 Chain M (length=54) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaaaacucuucucaugcuggauucgaaauuaggugcgcuucgcguuua
aguc
..................................................
....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8z99 Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		G21 E22 F37 R40 K52 G53 R56 S57 P80 G91 S92 M93 A96 H119 L120 R121 I122 R124 K127 D131 F133 G175 W176 L177 N178
Binding residue
(residue number reindexed from 1)		G20 E21 F36 R39 K51 G52 R55 S56 P79 G90 S91 M92 A95 H118 L119 R120 I121 R123 K126 D130 F132 G174 W175 L176 N177
External links