Structure of PDB 8y6u Chain J Binding Site BS01

Receptor Information
>8y6u Chain J (length=83) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PPLNALRVFDAAARHLSFTRAAEELFVTQAAVSHQIKSLEDFLGLKLFRR
RNRSLLLTEEGQSYFLDIKEIFSQLTEATRKLQ
Ligand information
>8y6u Chain 1 (length=68) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gagccattataaattgtccgttgagcttctaccagcaaatacctataatg
ggagctgtcacggatgca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8y6u NMR analysis of a loop-bulge structure of UUCGA pentaloop.
Resolution3.97 Å
Binding residue
(original residue number in PDB)		P7 V32 T33 A36 H39 Q40
Binding residue
(residue number reindexed from 1)		P2 V27 T28 A31 H34 Q35
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0009411 response to UV
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8y6u, PDBe:8y6u, PDBj:8y6u
PDBsum8y6u
PubMed38039839
UniProtP0A9F6|GCVA_ECOLI Glycine cleavage system transcriptional activator (Gene Name=gcvA)

[Back to BioLiP]