Structure of PDB 8xgc Chain J Binding Site BS01

Receptor Information

>8xgc Chain J (length=94) Species: 4932 (Saccharomyces cerevisiae)

RKRRPQVKLTAEKLLSDKGLPYVLKNAHKRIRISSKKNSYDNLSNIIQFY
QLWAHELFPKAKFKDFMKICQTVGKTDPVLREYRVSLFRDEMGM

Ligand information

>8xgc Chain X (length=51)

ttaaattttgcatacgatcgattaatttttgagtgtgttttttttttttt
t

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8xgc Parental histone transfer caught at the replication fork.
• Resolution: 3.7 Å
• Binding residue (original residue number in PDB): R48 R49 R126
• Binding residue (residue number reindexed from 1): R3 R4 R81

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003677 DNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000076 DNA replication checkpoint signaling
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0007064 mitotic sister chromatid cohesion
• GO:0008156 negative regulation of DNA replication
• GO:0031297 replication fork processing
• GO:0034087 establishment of mitotic sister chromatid cohesion
• GO:0043111 replication fork arrest
• GO:0043570 maintenance of DNA repeat elements
• GO:0045132 meiotic chromosome segregation
• GO:0051321 meiotic cell cycle

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0031298 replication fork protection complex
• GO:0043596 nuclear replication fork

External links

• PDB: RCSB:8xgc, PDBe:8xgc, PDBj:8xgc
• PDBsum: 8xgc
• PubMed: 38448592
• UniProt: Q04659|CSM3_YEAST Chromosome segregation in meiosis protein 3 (Gene Name=CSM3)